PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30903
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 101aa    MW: 11320.7 Da    PI: 8.4762
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30903genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-153984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WT eEd ll   v+++G g+W+ +  +++ gR++kqc++rw + 
         EMT30903 39 KGSWTVEEDTLLRVKVQEFGLGRWAEVTLYLP-GRSGKQCRERWTNQ 84
                     799*****************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9613489IPR017930Myb domain
SMARTSM007171.4E-133887IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-193988IPR009057Homeodomain-like
SuperFamilySSF466896.49E-173993IPR009057Homeodomain-like
PfamPF002494.7E-153984IPR001005SANT/Myb domain
CDDcd001672.66E-144183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MDPTSFPGYG SSDAPTAITA TARALPRARY SSQGLTRFKG SWTVEEDTLL RVKVQEFGLG  60
RWAEVTLYLP GRSGKQCRER WTNQLDPNIE VISQDLNFLT P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167937.12e-17putative MYB DNA-binding domain superfamily protein
SwissprotQ9S7L25e-15MYB98_ARATH; Transcription factor MYB98
TrEMBLM8C9W63e-70M8C9W6_AEGTA; Transcription factor MYB98
STRINGGRMZM2G150680_P015e-17(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2265446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-16myb domain protein 98